1. Notes: 262 / 15 hours ago  from airows
    airows:

(via TIPSY DRINKING GLASSES | onia | Blog)
     
  2. Notes: 75898 / 21 hours ago  from xx2 (originally from heiroin-deactivated20130519)

    en-crypted:

    you can always tell who has the most social confidence by who blows their nose in class 

  3. Notes: 1319 / 21 hours ago  from thedailywhat
    thedailywhat:

Nailed It of the Day: What an Okay Gift Mug for The World’s Okayest Dad
In honor of Father’s Day, Redditor MaryTerra designed this hilariously modest gift mug for his husband.

    thedailywhat:

    Nailed It of the Day: What an Okay Gift Mug for The World’s Okayest Dad

    In honor of Father’s Day, Redditor MaryTerra designed this hilariously modest gift mug for his husband.

     
  4. Notes: 2 / 1 day ago  from b3gad4ng
     
  5. Notes: 958 / 1 day ago  from larmoyante
    "

    Love is not a profession
    genteel or otherwise

    sex is not dentistry
    the slick filling of aches and cavities

    you are not my doctor
    you are not my cure,

    nobody has that
    power, you are merely a fellow/traveler.

    "
    - Margaret Atwood, “Is/Not” (via larmoyante)
  6. Notes: 35802 / 1 day ago  from kanyewesticleandthepeasants
    kanyewesticleandthepeasants:

my sister is the worst

    kanyewesticleandthepeasants:

    my sister is the worst

     
  7. Notes: 4083 / 1 day ago  from choriflaiweb
     
  8. Notes: 2757 / 1 day ago  from collegehumor
    collegehumor:

Sometimes You Gotta Sacrifice Eating to PARTY
Beer’s got protein, right?
     
  9. Notes: 1744 / 2 days ago  from theanimalblog
    theanimalblog:

A rare orange leaf-monkey baby was born in Sydney’s famous Taronga Zoo.
     
  10. Notes: 2017 / 3 days ago  from airows
     
  11. Notes: 972 / 3 days ago  from thedailywhat

    thedailywhat:

    Weird Tube of the Day: The Best-Worst Phone Conversation in History of Cinema

    Check out this awkwardly scripted dialogue scene from an unidentified 1980s South Indian film. It is one of the most dramatic phone conversations in film history.

  12. Notes: 162643 / 3 days ago  from tessofthederpervilles (originally from damnafricawhathappened)
  13. Notes: 6778 / 3 days ago  from therayway (originally from blackinasia)
    "Of course I am not worried about intimidating men. The type of man who will be intimidated by me is exactly the type of man I have no interest in."
    -

    Chimamanda Ngozi Adichie, TedxEuston (x)

    Omg, I LOVE her! She’s so incredible!

    (via blackinasia)

  14. Notes: 5016 / 3 days ago  from xx2 (originally from constantneverland)
     
  15. Notes: 96 / 3 days ago  from myfriendsaremarried

    When I book a $500 flight to my friends getaway bachelorette party

avatar_128
 
 
It is after all so easy to shatter a story. To break a chain of thought. To ruin a fragment of a dream being carried around carefully like a piece of porcelain.

To let it be, to travel with it, is much the harder thing to do.
 
 

Following

lookbookdotnuprettybooksninakixkari-shmatheanimalblogrobertolickystickypickysheairowsaudreyhepburncomplexthedailywhatlifeaminamanianewyorkerxx2shitmystudentswritemyfriendsaremarriedtheraywaythebluthcompanymichaelmcgeephdstressfcgthecoolwheninacademiatessofthederpervillestodayvictoriaisamessthedutybrit-smithbookshelfpornerinmjusticequranproject2013childrenwithswagwhatshouldwecallnorthwesternfuckyeahscrubswarsanshirethesoutherncolailovethe90spixarianatreblebasenpluspersonalscommissarietteshootingtheblankthingslikethatthisiskindalamehalloweenorwilliamsburgrowrowdarklovelyandsouthasianedwestwickisbeingridiculousxo-the-weekndtoseekandfindstufftotelljillianreluctantbuddhagabrielrjacksonfuckyeaheyegasmsszymonjackandmaddennewinuptownmadswanhibahlenajoimakeaplayfight-flightgalapsanehsabamsymbolicmiankashifrayani
 

Tumblr